A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks

A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks

thingiverse

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide backbone atoms are highlighted for clarity. Protein Data Bank ID: 1A0S The segmentation software used was Cura 4.5, while the 3D modeling and CAD software utilized was Chimera. The molecular data originated from crystallography.

Download Model from thingiverse

With this file you will be able to print A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks.