A beta sheet from a sucrose specific porin as surface

prusaprinters

<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID: 1A0S<br/> Segmentation Software: Cura 4.5<br/> 3D Modeling/CAD Software: Chimera<br/> Model Origin: Molecular data (e.g., crystallography)</p> <h3> Print Settings</h3> <p><strong>Printer Brand:</strong></p> <p>Creality</p> <p><p class="detail-setting printer"><strong>Printer: </strong> <div><p>Ender 5</p></div><strong>Rafts:</strong></p> <p>Doesn't Matter</p> <p><p class="detail-setting supports"><strong>Supports: </strong> <div><p>Yes</p></div><strong>Resolution:</strong></p> <p>0.2</p> <p><p class="detail-setting infill"><strong>Infill: </strong> <div><p>20</p></div><br/> <strong>Filament:</strong><br/> generic PLA <br/> <p class="detail-setting notes"><strong>Notes: </strong> </p><div><p>The model was re-orientated using the Auto-orientation plugin in Cura. I have used concentric supports and found to be easier to remove. </p></div></p> </p></p></p> Category: Biology