A beta sheet from a sucrose specific porin as surface

A beta sheet from a sucrose specific porin as surface

thingiverse

Beta-sheet extracted from the 1A0S PDB file, encompassing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, visualized as a surface for educational purposes in Biochemistry and Structural Biology. Protein Data Bank ID: 1A0S Segmentation Software: Cura 4.5 3D Modeling/CAD Software: Chimera Model Origin: Molecular data from crystallography.

Download Model from thingiverse

With this file you will be able to print A beta sheet from a sucrose specific porin as surface with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta sheet from a sucrose specific porin as surface.