stlfinder - 3d models search engine stlfinder - 3d models search engine
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible

A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible

thingiverse

Here is the rewritten text: Students examine a beta-sheet from 1A0S.pdb, comprising amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, depicted as a cartoon. The visualization emphasizes stabilizing hydrogen bonds between peptide backbone atoms and sidechains. This was created to facilitate teaching Biochemistry and Structural Biology classes. Protein Data Bank ID: 1A0S Segmentation Software: CURA 3D Modeling/CAD Software: Chimera Model Origin: Molecular data from crystallography studies

Download Model from thingiverse

With this file you will be able to print A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible.