
A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible
prusaprinters
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching Biochemistry and Structural Biology. Protein Data Bank ID: 1A0S Segmentation Software: CURA 3D Modeling/CAD Software: Chimera Model Origin: Molecular data (e.g., crystallography) Print Settings Printer Brand: Creality Printer: Ender 5Rafts: Doesn't Matter Supports: YesResolution: 0.2 Infill: 20 Filament: generic PLA Notes: The model was re-orientated using the Auto-orientation plugin in Cura. I have used concentric supports and found to be easier to remove. A few side-chains snapped, but I glued them back. Category: Biology
With this file you will be able to print A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible.