
A beta sheet from a sucrose specific porin as cartoon
thingiverse
A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role. This visualization was created for educational purposes in Biochemistry and Structural Biology classes. Protein Data Bank ID: 1A0S Software used for segmentation: Cura 4.5 3D Modeling/CAD Software: Chimera
With this file you will be able to print A beta sheet from a sucrose specific porin as cartoon with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta sheet from a sucrose specific porin as cartoon.