
A beta sheet from a sucrose specific porin as cartoon
prusaprinters
<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID: 1A0S<br/> Segmentation Software: Cura 4.5<br/> 3D Modeling/CAD Software: Chimera</p> <h3> Print Settings</h3> <p><strong>Printer Brand:</strong></p> <p>Creality</p> <p><p class="detail-setting printer"><strong>Printer: </strong> <div><p>Ender 5</p></div><strong>Rafts:</strong></p> <p>Doesn't Matter</p> <p><p class="detail-setting supports"><strong>Supports: </strong> <div><p>Yes</p></div><strong>Resolution:</strong></p> <p>0.2</p> <p><p class="detail-setting infill"><strong>Infill: </strong> <div><p>20</p></div><br/> <strong>Filament:</strong><br/> generic PLA <br/> <p class="detail-setting notes"><strong>Notes: </strong> </p><div><p>The model was re-orientated using the Auto-orientation plugin in Cura. I have used concentric supports and found to be easier to remove. </p></div></p> </p></p></p> Category: Biology
With this file you will be able to print A beta sheet from a sucrose specific porin as cartoon with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta sheet from a sucrose specific porin as cartoon.