A beta-sheet from a sucrose specific porin as balls and sticks

A beta-sheet from a sucrose specific porin as balls and sticks

thingiverse

A three-dimensional structure from the Protein Data Bank, designated as 1A0S, is visualized here with amino acids 334 to 387 of chain P prominently displayed. The sequence ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAIN is highlighted in balls and sticks representation. Hydrogen bonds stabilizing the peptide backbone are shown in bold, providing a clear understanding of their importance. For easier comparison, side chains are depicted as slightly smaller than the main chain.

Download Model from thingiverse

With this file you will be able to print A beta-sheet from a sucrose specific porin as balls and sticks with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta-sheet from a sucrose specific porin as balls and sticks.