A beta-sheet from a sucrose specific porin as balls and sticks

A beta-sheet from a sucrose specific porin as balls and sticks

prusaprinters

<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains are a bit smaller compared to the peptide backbone.<br/> I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID: 1A0S<br/> Segmentation Software: Cura 4.5<br/> 3D Modeling/CAD Software: Chimera<br/> Model Origin: Molecular data (e.g., crystallography)</p> <h3> Print Settings</h3> <p><strong>Printer Brand:</strong></p> <p>Creality</p> <p><p class="detail-setting printer"><strong>Printer: </strong> <div><p>Ender 5</p></div><strong>Rafts:</strong></p> <p>Doesn't Matter</p> <p><p class="detail-setting supports"><strong>Supports: </strong> <div><p>Yes</p></div><strong>Resolution:</strong></p> <p>0.2</p> <p><p class="detail-setting infill"><strong>Infill: </strong> <div><p>20</p></div><br/> <strong>Filament:</strong><br/> generic PLA <br/> <p class="detail-setting notes"><strong>Notes: </strong> </p><div><p>The model was re-orientated using the Auto-orientation plugin in Cura. Printed at 0.2 resolution with wall 4 lines I have used concentric supports and found to be easier to remove. Sidechains were quite strong, none snapped during the support removal.</p></div></p> </p></p></p> Category: Biology

Download Model from prusaprinters

With this file you will be able to print A beta-sheet from a sucrose specific porin as balls and sticks with your 3D printer. Click on the button and save the file on your computer to work, edit or customize your design. You can also find more 3D designs for printers on A beta-sheet from a sucrose specific porin as balls and sticks.