yae miko and sucrose 3d models

Any problem let me know and ill try to help you any way i can.

not affiliated with chuyafactory. ...default size is 100% of yae miko's

VF: Hello, Here is my 3D file creation that matches the sleeve detail for the Yae Miko cosplay from the game Genshin impact. For best results I recommend a light sanding and undercoating, before painting it the color of your choice. I wish you a...

Its Yae Miko from Genshin Impact the Kitsune of the Sakure Tree This Model already splited parts for printing and keyed Its have 6 piece on STL format I recomend Resin Printer for High Quality Prints Hope You Like This , If you have any questions...

4 parts for SLA print, 4 parts for FDM print

Wand stick up part size for a stick with a diameter of 2.5 cm there is a hole for attaching the flower to the tube Dont forget mirror flower <3

13 parts for 3d-print. ...In archive image with assembly plan

Free size 4 parts

Genshin impact Yae Miko E skill fox totem. It has designed for printing. It has 14cm x 5.5cm x 5cm sizes but you can rescale it what sizes you want. It needs minimal support, just for fox ears and maybe tail because of its weight. files included...

Inside ZIP file there will be 58 Parts of Yae Miko model (decreased to 34 for few pieces model) 2 Parts of base (Update) Add 7 parts instead of the old part for someone who wants a few pieces of the model. Recommend resin print Approximate scale of...

STL files for print My boosty: https://boosty.to/sindbad_workshop

Its Yae Miko from Genshin Impact the Kitsune of the Sakure Tree (Swimsuit Ver.) This Model already splited parts for printing and keyed *Its have 6 piece on STL format * I recomend Resin Printer for High Quality Prints Hope You Like This , If you...

Genshin impact Yae Miko's identical weapon. Includes high detailed stl files for 3D printing. It has 30cm x 30cm x 32 cm but sliced to parts which all are under 20 cm. All parts are printable with supports. Parts has plugs so all you should to do...

... small highly detailed jewelry). Yae Miko's Gohei. Default lenght of printed items - 500 mm. We sell only high-quality and highly detailed 3D models adapted for 3D printing. ...Buying 3D models from us, you get a correct and canonical product.

Please do not redistribute or resell the model. Commercial use is permitted. You can sell your prints. Happy printing! We'd love to see your printed products. Don't forget to tag us in your posts! ...http://instagram.com/fools.forge

I hope it helps you.

Mika transforms into a fearless warrior, wielding an ancient sword and sporting a fierce expression on her face.

Sucrose lenses from Genshin Impact. ... Print twice the shaft and the legs of the lenses.

Customized version of https://www.thingiverse.com/thing:4681765 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=4681765

Knob247 Initiation Exercise 2

Customized version of https://www.thingiverse.com/thing:3022244 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=3022244

Customized version of https://www.thingiverse.com/thing:74322 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=74322

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...

The sequence ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAIN is highlighted in balls and sticks representation. Hydrogen bonds stabilizing the peptide backbone are shown in bold, providing a clear understanding of their importance. ...For easier...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains are a bit...

The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are...

https://www.thingiverse.com/apps/customizer/run?thing_id=834725 Instructions Using the following options: twist = -10 Loop_position = 10 Rotation = 65 Font_name = Chewy height = [7.5,8.8,10,11.5,13] spacing = [13,14.5,12.5,12.5,14.5] Text = Miko...

One of the young female priestesses training against the dark arts against the Dark spirits and monsters that worships the sun goddess. ...She mastered with bow and arrows.

One of the young female priestesses training against the dark arts against the Dark spirits and monsters that worships the sun goddess. ...She mastered with sword fighting skill.