spongebob as a zombie 3d models

This is a ballhead (off centre) where you can snap light fixtures in (see my other designs). ...It is meant to snap onto a 43x43mm wooden beam that you can use as a "lighting rail"

A three-dimensional structure from the Protein Data Bank, designated as 1A0S, is visualized here with amino acids 334 to 387 of chain P prominently displayed. The sequence ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAIN is highlighted in balls...

For an exhibit, I required a secure dart game utilizing a drawing on a whiteboard or flipchart as target. The concept was to affix a magnet to one of the dart designs found online. However, this did not function well because the darts flew poorly and...

Tabaxi's are a fun race to use.   This is my take on the Cheshire Cat from Alice in Wonderland, as an anthro tabaxi / cat person.   I also think he'd make a great rakshasa, though some would agrue his hands would need inverting for that. Sculpt by me...

Wacom One PenTablet as DisplayThe Wacom One is a Pentablet / drawing tablet which supports of a 13.3 inch fullhd display, similar to the professional Wacom Cintiq tablets. The connection of Tablet is HDMI in and USB (for Power and...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...

... in the episode Blackened S05 E 13a. ... The files include all the parts separately for printing in stl format, not including the lenses. These I made by cutting acrylic with a soldering iron and polishing the edges, they can also be laser cut.

People are frequently presented with an arrangement of flowers as a thoughtful gesture. ... 9 out of 10 three-dimensional images created by me undergo quality control checks to ensure they meet certain standards, consisting of precision-made prototypes...

Here is the rewritten text: Students examine a beta-sheet from 1A0S.pdb, comprising amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, depicted as a cartoon. The visualization emphasizes stabilizing hydrogen bonds...

Idea draft - solar powered mini houseboat as a bicycle trailer Size: unfolded: length 380 cm Width: 200cm The motorized width can later be reduced to approx. 90 cm at the push of a button. The open side windows can be closed electrically. Of...

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...

Spongebob squarepants fridge magnet. ... This takes 2x ø6mm x 2mm neo magnets. I couldn't add this as a remix but it sourced from https://www.thingiverse.com/thing:85816

The iconic Spongebob Squarepants logo stands out as a beacon of fun and excitement. ...If you spot any errors or require adjustments to this beloved symbol, please don't hesitate to reach out to the right person for assistance.

iMakr and MyMiniFactory.com have joined forces with Holbrook Primary school in Suffolk as part of an educational program aimed at teaching kids from primary schools the skills needed to design for 3D printing. ... Lottie has created a SpongeBob model.

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains are a bit...

Just a door stopper. ... Thank you Alsamen for the amazing Spongebob model.

The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are...

Students delve into the world of wind energy as part of their comprehensive study on renewable energy systems. ...Through hands-on exploration, they gain valuable experience designing, printing, testing, and refining their very own wind turbine blades...

This is a head end and tail end of a reindeer that can be connected using a wine bottle cork. ...Just for fun...

This is a head end and tail end of a reindeer that can be connected using a wine bottle cork. ...Just for fun...</p>

This portrait embodies the quintessential characteristics of an idealized Italian Renaissance beauty - a slender, elongated neck, a perfectly rounded face, and a notably high forehead. ...The subject's piercing stare lends her a distinct, one-of-a-kind...

A Base for a Pendant Lamp Shade Featuring a Square Pattern The initial plan called for installing a four-cell battery holder and boost converter within the base. However, I ultimately only created a cavity to fit the boost converter, allowing me to...

Miletus (Turkey), built into the "Goths' Wall"From a 1905 excavation of finds; marble, dating from 540 - 530 BC The torso of this statue of a girl was unearthed incorporated into a fortification wall of the third century AD alongside other antiquated...

Scan the World is a Non-Profit Initiative Introduced by MyMiniFactory, Through Which We Are Creating a Digital Archive of Fully 3D Printable Sculptures, Artworks, and Landmarks From Across the Globe for the Public to Access Free of Charge. ...Scan the...

Using this process molds the silicone necessary for creating a proof-of-concept sensor prototype. Creating Sensors from Silicone Instructions: PLA is the material of choice. Position the extruder at an upright angle for...

This is a remix of Boris3DStudio's exceptional model, featuring a colossal snake encircling a young girl. I downscaled the entire design to match D&D miniature size and eradicated some of the bandages. The next step involved separating the girl from...

Each character has approximately 60,000 polygons and is available in various formats: 8K texture maps with masks for skin, hair reflection, clothing, and shoes; contour billboard hair for realistic appearance; Vray SSS2 shader in 3ds Max 2012, a...

The extruder is cleverly linked to my E3D-V6 via a brief segment of Teflon tube positioned at the front. The current setup has consistently delivered impressive results, far surpassing expectations in several instances. Printing with this setup...

Spongebob Squarepants Cookie cutter

Spongebob Cookie Cutter