spongebob as a zombie 3d models

To produce a Headcrab Zombie, use the identical files for its upper torso, which requires support material and should be printed upside down. Attach the arms and legs from this Thingiverse link: http://www.thingiverse.com/thing:170076. Assemble by...

This a quick and easy to use card holder that doubles as a vase. ...Just print in you normal vase mode settings.</p>

Remix of a zombie by Harry Baere sourced from an alternate site, with a link provided below. The design has been enhanced with a figure base added via Netfabb software and resized to perfectly fit within the dungeons and figures used for gaming...

Here is a rewritten version of the original text: A lifelike 3D model of a zombie springs to life, showcasing its undead state with animated movements. ...Its appearance is eerily realistic, thanks to the advanced PBR (Physically Based Rendering)...

Developed a slender, hipster-inspired zombie for the Character class project, requiring several days to solidify concepts and roughly a month to design, sculpt, texture, and animate the 3D model. ...The finished product boasts an impressive 6982...

Update 1.01 Includes Enhanced Leg Texture A Classic Zombie Model Boasts Advanced Features with Pivots and Three High-Quality Textures. ...Comprehensive Package Includes: 3D Max Software Files for Precise Modeling Object (OBJ) Files for Seamless...

This is a character model from our project "Zombies Run". If you're interested, check out the full product here: https://play.google.com/store/apps/details?id=com.cgamemobi.zombifyme & https://itunes.apple.com/us/app/zombify-me/id1169073264?mt=8.

Human: Highly detailed zombie model with intricate surface characteristics.\nFull and separate models are included.\n\nFull Model:\nContains a total of 450,000 vertices and 900,000 faces.\n\nSeparate Models:\nBody: Features 240,000 vertices and...

This comprehensive model includes both a complete and separated version for maximum flexibility. ... Complete Version: Verts - 450,000 Faces - 900,000 Separated Version: Body - Verts - 240,000 Faces - 480,000 Legs - Verts - 210,000 ...

Offer you here a wild boar as a napkin holder, Thickness is 16 mm, hole 30 mm Surprise your guests with a fancy design for a change. Choose the color that best suits your table decor. Be bold with the color! Why not print a blue or green one?

570-485 BC) on the basis of similarities with the portrait type then commonly associated with the figure (of whom, for instance, there is a portrait with an inscription bearing his name in the Musei Capitolini in Rome), this head with its band ending...

A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role....

On the outer sides of this box, a regular pattern was made, made up of rectangular segments that are bulging, and which extend over the entire circumference of the glass itself. The edges are rounded so that the user does not get hurt or cut on sharp...

This exquisite kore stands out as an offering due to its inscription: "Cheramyes has erected me, an incredibly beautiful statue, in honor of the goddess." The delicate figure cradles a hare in her hand, symbolizing a votive gift. This remarkable...

Beta-sheet extracted from the 1A0S PDB file, encompassing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, visualized as a surface for educational purposes in Biochemistry and Structural Biology. ... Protein Data...

... is part of "Scan The World", a non-profit endeavor launched by MyMiniFactory. It's an ambitious project aimed at building a digital repository of fully 3D printable sculptures, artworks, and landmarks worldwide for public access without cost.

... ...This doubles as a flag holder by the entrance, making it a convenient addition to any home. The bottom section that holds the key slides smoothly to the left, concealing it from view - even though it appears to be secured tightly with a fake screw.

To make the most of this design, I've also created a few extra sleeves that allow you to use thinner poles, such as small seasonal flags. Even if you don't need a key holder, you can still use this design to conceal a note or other small item. ...And...

I also created a few additional sleeves that allow you to use a thinner pole, such as a small seasonal flag. Even if you don't want to store a key, you can use this design for hiding notes or other items. This design may not be visually appealing,...

SpongeBob for the wall. ...It's a great decorative piece.

A model for spongebob pirate mode have fun!

A model for spongebob pirate mode have fun!

The characteristic features of this portrait (a forked beard, the way the hair is arranged on the forehead and the piercing gaze emphasised by tightly etched lines) are strongly reminiscent of the portrait of Epicurus (342-270 BC), a native of Samos...

UPDATE 8-15-19 newer better version is: https://www.thingiverse.com/thing:3812013 A convenient way to keep a key close at hand, this design doubles as a flag holder by your door. The bottom portion that holds the key slides to the left, despite...

Featuring a student with glasses, books, tablets, and various accessories, she can be used indoors or outdoors wearing different outfits and objects. With superior quality textures and materials, this model boasts 8K skin textures and one polymesh...

https://youtu.be/TE63B3ymtIA This is a demonstration of converting a cheap tire gauge into a digital probe. I designed this to measure the cut depths of ordinary brass house keys for a key duplicating machine project I'm working on. Probe Carriage:...

DOES NOT REQUIRE SUPPORTS Works great with PLA If you like our work, support us on Patreon, there you can have a commercial license to be able to sell our designs, physical pieces. https://www.patreon.com/rogistudios We really appreciate your...

With this purchase you receive:- Zombie miniature.- scenic round base. A pre-supported version is included! This miniature is from the “Dungeon of Despair” Kickstarter collection. See our latest releases on our Patreon or Tribes page. This miniature...

I'm a huge fan of undead creatures too - there's something so fascinating about them, don't you think? Maybe it's the way they shuffle along, their brains completely gone but still somehow managing to stumble from one place to another. Or maybe it's...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...