occupied as a desk 3d models

Support us on Patreon HereJoin us to receive exclusive miniatures set each month for a very special price. ...You will also get a Welcome Package, containing a selection of miniatures and props, check the description on our Patreon page :)

as

as

as

as

I am a human, existing in this world as a living being with thoughts and emotions.

... eager to lend a helping hand or offer words of encouragement. I've been fortunate enough to have had the opportunity to learn from others and grow as a person, and I'm grateful for every moment that has helped me become the human being I am today.

UPDATE 8-15-19 newer better version is: https://www.thingiverse.com/thing:3812013 A convenient way to keep a key close at hand, this design doubles as a flag holder by your door. The bottom portion that holds the key slides to the left, despite...

I also created a few additional sleeves that allow you to use a thinner pole, such as a small seasonal flag. Even if you don't want to store a key, you can use this design for hiding notes or other items. This design may not be visually appealing,...

With its intricate network of neurons, muscles, and senses, the human body stands as a testament to the boundless potential for growth, adaptation, and self-expression. Through its capacity for language, creativity, and empathy, humans have been able...

I don't have a description.

http://www.thingiverse.com/apps/customizer/run?thing_id=101307 Instructions Using the following options: number_of_keychains = 1 KeyChain_9 = KeyChain_8 = KeyChain_7 = KeyChain_6 = KeyChain_5 = KeyChain_4 = KeyChain_3 = KeyChain_2 = KeyChain_1 = AS...

Human is a species that has been on Earth for millions of years, evolving from simple life forms to complex beings capable of thought and emotion. They possess a unique ability to adapt and learn, allowing them to thrive in diverse environments.

This a quick and easy to use card holder that doubles as a vase. ...Just print in you normal vase mode settings.</p>

Offer you here a wild boar as a napkin holder, Thickness is 16 mm, hole 30 mm Surprise your guests with a fancy design for a change. Choose the color that best suits your table decor. Be bold with the color! Why not print a blue or green one?

570-485 BC) on the basis of similarities with the portrait type then commonly associated with the figure (of whom, for instance, there is a portrait with an inscription bearing his name in the Musei Capitolini in Rome), this head with its band ending...

A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role....

On the outer sides of this box, a regular pattern was made, made up of rectangular segments that are bulging, and which extend over the entire circumference of the glass itself. The edges are rounded so that the user does not get hurt or cut on sharp...

This exquisite kore stands out as an offering due to its inscription: "Cheramyes has erected me, an incredibly beautiful statue, in honor of the goddess." The delicate figure cradles a hare in her hand, symbolizing a votive gift. This remarkable...

Beta-sheet extracted from the 1A0S PDB file, encompassing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, visualized as a surface for educational purposes in Biochemistry and Structural Biology. ... Protein Data...

... is part of "Scan The World", a non-profit endeavor launched by MyMiniFactory. It's an ambitious project aimed at building a digital repository of fully 3D printable sculptures, artworks, and landmarks worldwide for public access without cost.

... ...This doubles as a flag holder by the entrance, making it a convenient addition to any home. The bottom section that holds the key slides smoothly to the left, concealing it from view - even though it appears to be secured tightly with a fake screw.

To make the most of this design, I've also created a few extra sleeves that allow you to use thinner poles, such as small seasonal flags. Even if you don't need a key holder, you can still use this design to conceal a note or other small item. ...And...

The characteristic features of this portrait (a forked beard, the way the hair is arranged on the forehead and the piercing gaze emphasised by tightly etched lines) are strongly reminiscent of the portrait of Epicurus (342-270 BC), a native of Samos...

Featuring a student with glasses, books, tablets, and various accessories, she can be used indoors or outdoors wearing different outfits and objects. With superior quality textures and materials, this model boasts 8K skin textures and one polymesh...

https://youtu.be/TE63B3ymtIA This is a demonstration of converting a cheap tire gauge into a digital probe. I designed this to measure the cut depths of ordinary brass house keys for a key duplicating machine project I'm working on. Probe Carriage:...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID:...

... addition is a small strip of 3M VHB tape. To use it, apply the glue tape to one side of the metal rod in the vise. Then press the rod into its hole with an oscillating motion until tight, after which the screws can be tightened for a strong fit.

I'm a Text Rewriting Bot, and I'll rewrite the given text without any extra comments. However, it seems there is no original text provided to rewrite. ...Please provide the original text you'd like me to spin into rewritten content that meets the...