lowpoly tree 3d models

Here is the text rewritten as required: Human-designed low-poly 3D model of a majestic tree featuring advanced level-of-detail functionality. ... Content includes: Three intricately layered levels of detail, ensuring seamless performance in a wide...

This Low Poly 3D Tree Model Includes: Multiple Layers for Detailed Viewing * 3-Part Layer System for Increased Realism and Flexibility Each Layer Offers a Different Level of Detail for Maximum Visual Impact Optimized for Use in a Variety of...

A low-poly 3D tree model consisting of multiple components has been designed. The model includes three different levels of detail (LODs) for optimal rendering efficiency. ... Each layer can be customized independently to create the desired visual...

The 3D representation consists of a simplified low-poly tree structure containing three levels of detail. Three distinct versions exist, designed to offer varied visual sophistication based on the complexity of their environments. ...These multiple...

Low Poly Tree Model in 3D The Model Consists Of Three Main Layers: Highest Level: This Layer Includes All Major Details Such As Leaves, Branches And Roots. Mid-Range Level: The Next Level Displays Essential Components Like Large Twigs And A...

The Low-Poly Tree Model consists of three detailed levels of detail. These LOD layers allow for smooth performance optimization, catering to varying computational capabilities while ensuring visually striking imagery is always rendered on-screen. ...The...

This is a low-poly three-dimensional model of a tree that contains multiple levels of detail (LOD). The model consists of 3 separate parts or "layers" which provide varying amounts of visual fidelity and rendering speed depending on how close or...

From afar, this 3D tree is a striking silhouette against the landscape, its delicate curves and angles begging to be studied further as the viewer moves closer in for a detailed inspection. Inside this design are hidden moments waiting to unfold -...

A bundle of 7 distinct lowpoly fir trees is available in 3 varying seasonal iterations: vibrant summer green, autumnal orange hues, and snowy winter. 27 individual assets make up the complete set. ... Detailed triangle counts for each tree in Blender:...

Here is the spun version of the original text: This low poly 3D model brings a touch of simplicity to the complex form of a tree. It includes three detailed levels of detail (LOD), allowing users to zoom in or out and appreciate its unique design.

This low-poly 3D model depicts a majestic tree. It consists of three distinct layers, offering different levels of detail depending on proximity to the viewer. The lowest level provides basic shapes, used at far distances or in environments where...

A minimalist low-poly 3D model of a tree consists of multiple levels of detail to ensure optimal performance across various systems and hardware configurations. It features three distinct levels of complexity: 1. High-level rendering with intricate...

This low-poly 3D model showcases a stylized representation of a tree, optimized for seamless rendering across varying distances. Key features include: Three distinct levels of detail (LODs) allowing for efficient loading and real-time rendering in...

This is a low-poly three-dimensional (3D) model of a tree. It contains: Three levels of detail (LOD), which enables the creation of high-quality visuals and smooth performance, even on less powerful hardware devices such as mobile phones or low-end...

Low Poly 3D Model for Virtual Reality, Augmented Reality, Games and Real-Time Apps --------------------------------------------------- The Simple Tree 01 low-poly 3D model is now ready for deployment in various immersive environments, including...

Here's a low-poly 3D tree model with advanced detail that catches the eye. It includes several elements to enhance its realism and make it feel more like a living being. The 3D model features: A series of three main layers with progressive details...

Textures:- Ultra-High Quality Stylized Colorful Tree Textures Polygons:- Game-Ready Highly Detailed Lowpoly Stylized Trees and Bushes 3D Models Bush1: LOD0 Verts/1200 & Faces/600 Tree1: LOD0 Verts/4200 Faces/2400 Tree2: LOD0 Verts/4800 & Faces/3200...

Introducing our GameReady Cartoon Pine Trees Pack! Included are 128 color palette textures (in PNG format) with meshes centered at 0,0,0 for X/Y/Z. Mesh scales and rotations are set to 1,1,1 and 0,0,0 respectively. Created in Blender, the files come...

Humans Crafted Low-Poly Tree Models with Five Different Texture Colors and a Resolution of 512x512 Pixels in TGA Format. ...These Models Are Compatible with Autodesk's 3D Studio Max Software Versions 2010 Through 2012.

This is a Low poly forest pack. This model is perfect to create a stylized low poly forest. ...It has been modeled in Autodesk Maya and doesn't need any kind of texture, just simple materials which can be modified easily.

Lush Forest 3D Asset Features Densely Modeled Foliage for a Vivid Realism and a Naturalistic Rendering of Nature's Complexity, Captivating Audience Imagination by Enabling High-End Visualizations in Games.

Three-dimensional digital representation with reduced polygon count featuring a realistic image of a deciduous or evergreen plant.

Here is a rewritten version of the text. The Model Consists Of Three Distinguishable Layers That Are Gradually Refined As Viewers Move Further Away From The Subject. ...A Series Of Discrete Models Have Been Designed To Accommodate This Principle,...

Game Ready Cartoon Pine Trees. Standard materials are used throughout. Mesh objects are strategically centered at scene coordinates 0,0,0 for X/Y/Z axes. Their scales and rotations are set to optimal levels of 1,1,1 and 0,0,0 respectively. Created...

... scene included! Please rate this product if you liked! Additional formats: fbx, obj, blend, mb, unitypackagetreestreelandscapeforestplantsflowerflowersnaturegamelowpolyrockenvironmentexteriorfantasyrpgmedievalgrassgardenplantcartooncartoon tree

Here is the spun text: Human: Winter Wonderland Lowpoly Tree Server Base Crafted and Rendered with Precision in Blender Features: -Six Distinct Format Options Included: Blender (Default), 3ds, fbx, dae, obj, and more -Blender Scene and Node Set Up...

No description is available.

Here is the rewritten text: Human being behaves just like a regular human would. The system is instructed to behave like a Text Rewriting Bot. I am going to rewrite this text exactly as it was originally written, using the same tone, voice and...

This is an awesome low-poly visual setup that's perfect for incorporating into an animated sequence, and its individual components can be easily integrated into any personal project.

The asset sculpting process is designed to be an extremely time-consuming and labor-intensive endeavor that requires a tremendous amount of dedication and expertise to master. As such, it's not something that should be taken lightly by anyone looking...