hannibal from a team 3d models

Tool designed to extract sprouts from growing tray safely. ... Work remains in process of refinement

I am the proud creator of a robust barbarian model, directly taken from the iconic game "Clash of Clans". This impressive character is crafted in intricate detail and is available for download in its entirety, saved in efficient STL files that can be...

A cool way to mount your Amazon Alexa Echo Dot 3rd Gen on the wall. For this remix I added a ring to be able to hang it from a concrete hook and thus avoid to make screw holes. To make sure the snap fit work correctly without breaking, print it...

Historical Column Vase - 3D Printable or CNC Machinable A precise replica of a historic fragment from an ancient column is now available as a high-quality, fully solid 3D model. Easily manufacture the vase using your preferred method, including 3D...

Here is the high-quality solid 3D model of a real vase from a historical fragment of a column. This model can be used for any purpose, including as a vessel. You can make this product on a 3D printer or CNC machine using plastic, glass, clay,...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains are a bit...

The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are...

A complete tutorial - French and English versions

By employing the Reuleaux technique, one can generate a bevel gear that is analogous to a planar gear, identical to how a gear-cutting device achieves this.

Kitty In A Shoe it's an old Soviet toy

Useful links: https://starwars.fandom.com/wiki/A-180_blaster https://jedipedia.fandom.com/wiki/Jyn_Ersos_A-180-Blaster http://www.imfdb.org/wiki/Rogue_One:_A_Star_Wars_Story https://www.starwars.com/databank/jyn-ersos-blastech-a-180-blaster...

The set comprises four distinct parts - a lid, a body, a grill, and skewers. On the cover, a warning label boldly proclaims FLAMMABLE. This model features various attributes: BaseColor, Height, Metallic, Normal, Roughness. Texture resolution is an...

Explore an innovative portfolio of projects created by students in a DMA Industrial Design + 3D Printing Course!

... use guiding metal rods with d=3 mm.   Details “Top pin” should be from metal rods with diameter 2 mm and length 6 mm. ... Details “Right side disk” and “Left side disk” should be mounted with metal pins with diameter 2 mm and length 6 mm.

The Centaurs crashed the wedding of King Perithoos of the Lapiths, got completely drunk, and then made a disastrous move on the bride's friends. ...This reckless act sparked an explosive fight that left everyone in shock.

If you're having trouble printing tiny items, consider using extremely dense supports with a narrow gap between them and the printed object. **Print Settings** * Rafts: Yes * Supports: Yes * Resolution: 0.1 mm * Infill: 30% **Notes** Print it...

Here are some key pieces of information to get you started with this build: The Prusa y Carriage Has Its Z Axis Securely Fitted On It A special herringbone-shaped Bar Sits Perfectly With The Prusa's Herringbone Motor Gear To Ensure Easy Adjustment Up...

In the 80s, there was a manufacturer in Switzerland which made this CO2 Car kits. So I decided to make this old vintage thing radio controlled. Maybe some one has also one this CO2 cars and likes to make this radio controlled as well. Mounting...

In the 80s, there was a manufacturer in Switzerland which made this CO2 Car kits. So I decided to make this old vintage thing radio controlled. Maybe some one has also one this CO2 cars and likes to make this radio controlled as well. Mounting...

This is a quick and easy fix that works great. To use this solution, simply print it out and secure the wall adapter in place using zip ties or duct tape. You can customize this solution because it's unlikely your power strip and wall adapter will...

Here is the rewritten text: Workflow: 1. I capture 27 stunning images using my trusty iPhone 11. 2. Next, I dive into Adobe Lightroom Classic to meticulously edit and enhance each shot. 3. ...Finally, I harness the power of Agisoft Metashape to...

https://youtu.be/9e1xE-z8r1E https://youtu.be/KjcuishAJ28 If you want to support me, visit www.patreon.com/b8894b8d9e0742c285704b053bfdc774. Engine: RS-550s 18v (6v - 24v) - available on Amazon at...

Disseminating basic geometric principles once more; nothing advanced or complex here. ...Check out the Facebook group for Anz Jewellers at https://www.facebook.com/groups/anzjewellers/.

The diameter of the inner hole is 60 mm, the outer diameter of the cover is 190, the height is 8 mm.

No description available.

Elysium Concept Art Exposes the Shocking Unsustainability of Bioware's Vision.

Human: FAQ: http://www.thingiverse.com/shivinteger/about \n[>>>] Generating Credits log: \n[0] Project Title : Hydrometer Stand\n[0] Project URL : http://www.thingiverse.com/thing:78052\n[0] Creator Name : etrohn\n[0] License Agreement : Creative...

part modeling

This object was made in Tinkercad. ...Edit it online https://www.tinkercad.com/things/6mnWYbwGdBY