hannibal from a team 3d models

A picture of a cat wearing a business suit running away from urban turmoil.Print at 100% infill.

This skull likely topped a grand tombstone. ...Its prominent browbone and deeply sunken eyes create a striking visage, reminiscent of sculptures linked to Skopas, a renowned artist from ancient Greece's fourth century.

This is a 3D model of a Cashier from a cute bar. Modeled in Autodesk Maya and textured in Substance Painter. This model is a low poly game ready model. ...It was done in order to be use in a bar.

Beta-sheet extracted from the 1A0S PDB file, encompassing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, visualized as a surface for educational purposes in Biochemistry and Structural Biology. ... Protein Data...

... I'm unsure whether the file will successfully print. As a potential workaround, creating a base that matches the sculpture's height could help ensure proper printing alignment. ...If anyone decides to give it a try, feel free to share your results!

Today I'm going to attempt printing a test piece of tape cut from a plastic PET bottle, without going through the machine. Almost 10% of municipal landfills are comprised mainly of PET waste - all this can be recycled without incurring global costs!...

Handley Page HP42 It is built near to scale and includes a lot of detail and consequently is a very high poly model. The model is also fully textured and comes with the materials and textures shown here. The model is also provided in several...

... only. It is built near to scale and includes a lot od detail and consequently is a very high poly model. The model is also fully textured and comes with the materials and textures shown here. The model is also provided in several formats. ...

... the Kimballs, embarked on an extravagant journey through 19th-century Europe to witness ancient landmarks firsthand. ...In 1887, during a trip to Rome, they hired renowned sculptor Orazio Andreoni to create custom portrait busts of themselves.

It is built near to scale and includes a lot od detail and consequently is a very high poly model. The model is also fully textured and comes with the materials and textures shown here. The model is also provided in several formats. The HP-42 and 45...

... formats for flexibility. The HP-42 and 45 by Handley Page were four-engine airliners, custom-built for Imperial Airlines based on a 1928 specification. ...A total of eight units were manufactured, split evenly between the HP-42 and HP-45 models.

The Handley Page HP-42 and 45 were four-engine airliners manufactured by Handley Page to fulfill a 1928 Imperial Airlines specification. A total of eight were constructed, including four HP-42s and four HP-45s. After serving for 11 years, three...

It was inspired by a dealer button in Pokerstars VR. Printing: Ring - Infil to add weight, supports needed for spade inset. Letter embossing doesn't need it. Spade - Infil to add weight, no supports Letters - Print flat, already scaled to...

Featuring intricate exterior details, this in-flight animator model is nearly scaled and boasts a high poly count due to its numerous components. It comes with textures and materials as shown and is available in various formats. The HP-42 and 45,...

A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role....

The head of a massive griffin carved out of sandstone originally topped a colossal Roman tomb monument situated along the main road connecting Cologne to Trier and likely served as a prominent feature for a lavish Roman estate whose exact location...

The rendering depicts a woman clad in a chiton and himation that envelops her head and torso, visible from the hips up. Her right hand grasps the hem of the himation as her left arm hangs parallel to her body. This distinctive type of funerary statue...

#### Sphericon Models, Starting from a Square or a Circle The sphericon is a simple yet fascinating mathematical structure that is worth playing with using design technologies. It can be constructed (or developed) from a square or a circle, with a...

Sphericon Models, Starting from a Square or a Circle The sphericon is a simple yet fascinating mathematical structure that is worth playing with using design technologies. It can be constructed (or developed) from a square or a circle, with a twist...

A man sipping water from a bottle looks relaxed, sitting comfortably with his feet up and wearing a casual brown t-shirt. Polycount stands at 100K, 300K, 500K for the decimated model that has been created. The formats available are OBJ only. ... The...

The head of a cleric is depicted on a tomb effigy, dating from 1450-60, crafted in France using Janmont limestone. With or without its base, the sculpture measures 24.5 x 17.2 x 19.2 cm and 41.3 x 14.5 x 19.2 cm respectively. Classified as a stone...

Head of a Cleric from a Tomb Effigy Date: 1450-60 Geography: Made in France Culture: French Medium: Janmont Limestone Dimensions: The overall size is 9 5/8 x 6 3/4 x 7 9/16 inches, and the total dimensions with base are 16 1/4 x 5 11/16 x 7 9/16...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID:...

I know, there are not many people who need a replacement ball for their lamp, but it should be more of a food for thought that you don't have to throw everything away and that you can still repair one or the other. The Blender file is included so...

The luminaire was equipped with an LED transformer and 1.8 watt LED bulbs from Osram that emit almost no heat - now you can even print the domes in PLA - and even have the free choice of the sphere shape and colour,We stayed with the classic round...

... ...I was the team captain for the year 2011-12 and we designed "SPYTHUN V". We placed 17th in the world. Engine: OS61FX Wingspan: 11ft Payload capacity: 20lbs approx. ...Balsa wood and Beechwood ply construction with aluminium pipes for tail boom.

Here we go: A compact package is being designed featuring a sturdy frame-stand to support garden wire, accompanied by a convenient spool holder. ... The current project has evolved to include a bracket for securely attaching 6mm wire to the spool,...

A likely candidate for an ancient relic is this head of a youthful female, which was probably part of a fully realized sculpture standing sentinel within a sheltered shrine - known as a naiskos - marking the final resting place of one long gone.

A replica of Westin's Shad Teez Sleem bait Model for printing on a 3D printer, used for self-made soft fishing baits.