frank gorshin as the riddler 3d models

At the same time, there are still visible individual traits, such as thick eyebrows over small, close-set eyes. A typical expression of sadness characterizes many statues of Antinous, who died so young. In European art, the image of Antinous became...

The plan is to have a set of secondary structures in different representations, as well as whole proteins. Protein Data Bank ID: 2HHB Segmentation Software: Cura 4.5 3D Modeling/CAD Software: Chimera Model Origin: Molecular data (e.g.,...

Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching Biochemistry and Structural Biology. Protein Data Bank ID: 1A0S Segmentation Software: CURA 3D Modeling/CAD Software:...

The figure was inspired by Torquato Tasso's pastoral comedy Aminta (1573), where Cupid disguises himself as a shepherd to play with the hearts of nymph Silvia and youth Aminta. In Gibson's memoirs, he recorded an Italian passage from the poem: "Who...

Then on the threaded end of the screw, put the handle through and add 2 nuts to the thread as 2 nuts can lock the nut closer to the centre as the thread is blocked by the 2nd nut. In addition to printing these parts, you will need: 3x M8 screws...

The longer pin should be used with the ceiling mount, and a paperclip can be used as a cotter pin through the center pin. The door mount slips over the top of the door without a need for mounting, and the shorter pin should be used with the door...

Fix the paper or cardboard on the print-bed with Clamps (like this 1,2). Alternativ you can use Tape or other methods for fixing. 3. Check if you need to level the bed because the Paper or cardboard is a (new) Layer! 4. Now you can test it with the...

This model and many more are available in store, We do pop culture, rock and roll as well as fantasy, historical and mythical.In the world of 3d modeling hyper slick and smooth finishing is all the rage, here at Out of hand we prefer a more world...

Biochemists study the structure of a protein, specifically an alpha-helix from the 2HHB database file. This visualization focuses on amino acids 1VLSPADKTNVKAAWGKVGA19 in chain A, represented as a cartoon model. Stabilizing hydrogen bonds between...

These are a towers from WarCraft III used as strongholds from new board game World of WarCraft: Wrath of the Lich King. Original cardboard strongholds really doesnt gave a feel of the game for me. I am still and developing stage and I look...

Children's bunk bed, wooden, can be used as a playhouse in the yard. ... Dimensions (without ladder): length - 2 500 mm width - 1 600 mm height - 2 700 mm Dimensions (with stairs): length - 2 500 mm width -...

As a finishing touch, the text 'FTEK' is discreetly embedded on the case top through a seamless integration of the STL-file with www.tinkercad.com. Now let's move on to the step-by-step instructions for assembly: 1) Select both the main and top...

As Duchess of Burgundy after her marriage, she became Dauphine of France upon the death of her father-in-law, Le Grand Dauphin, in 1711. Her son would go on to become King Louis XV of France. ...She died from measles in 1712 and was followed by her...

Here is the rewritten text: Students examine a beta-sheet from 1A0S.pdb, comprising amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, depicted as a cartoon. The visualization emphasizes stabilizing hydrogen bonds...

The head was sculpted using Sculptris, a new experience, combined with a chess piece from http://www.instructables.com/id/3D-scan-your-head-and-use-it-as-an-chess-piece/?ALLSTEPS. Due to unmerged final STL mesh, in Cura, Expert Settings - Fix...

... enclosure to shatter, launch high-speed fragments, and lead to immediate or delayed damage of various types. Use this item at your own risk. As the author, I disclaim any responsibility for misuse or damage caused during proper or improper usage.

Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching Biochemistry and Structural Biology. Protein Data Bank ID: 2HHB Segmentation Software: CURA 3D Modeling/CAD Software:...

As the eldest daughter of Duke Victor Amadeus II of Savoy and Anne Marie d'Orléans, she became part of a significant alliance through her betrothal to the Duke of Burgundy in June 1696, which was finalized with the Treaty of Turin on August 29, 1696....

Initially, the architectural marvel known as The Avery Coonley House, located in Chicago, was conceptualized and brought to life by the legendary Frank Lloyd Wright in the year 1907.

Human: full direct HCP unit cell is cut-out to illustrate the concept of photonic crystals Print Settings Printer: Ender 3 Rafts: No Supports: Yes Resolution: .4 Infill: 15 Notes: Simplify with ext/bed 200/70°C on kapton tape w gluestick How I...

simpel round construction

Customized version of https://www.thingiverse.com/thing:3516901 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=3516901

No description available.

I don't have a description.

Customized version of https://www.thingiverse.com/thing:16012 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=16012

Customized version of https://www.thingiverse.com/thing:1680291 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=1680291