fokker d xxiii 3d models

My collection of meticulously crafted 3D planes continues to take shape with my Fokker T.8 - a Dutch Reconnaissance Seaplane showcasing a pivotal part in my ongoing Series of World War Two Aircraft (and beyond) that I've been tirelessly building over...

www.thingiverse.com/apps/customizer/run?thing_id=1343760 Instructions Using the following options: Letter = D Font Y Position = -9.5 Circle Height = 2 Circle Radius = 16 Hatch Thickness = 1 Font X Position = -7 Hatch Angle = 315 Hatch Spacing = 3...

http://www.thingiverse.com/apps/customizer/run?thing_id=749887 Instructions Using the following options: basethickness_percent = 0% baseheight_percent = 0% wall = true base_radius_add_percent = .1% textstring = D textheight = 40 points RoundedBase =...

https://www.thingiverse.com/apps/customizer/run?thing_id=749887 Instructions Using the following options: textsize = 25 RoundedBase = 0 baseheight_percent = .33 base_radius_add_percent = .1 basethickness_percent = 0.1 fontname = Bowlby One SC wall =...

http://www.thingiverse.com/apps/customizer/run?thing_id=139461 Instructions Using the following options: TextSpacing = 10 TextRelief = -10 Text = D ManualThickness = 1.75 build_plate_manual_y = 100 build_plate_manual_x = 100 ColumnSpacing = 0...

http://www.thingiverse.com/apps/customizer/run?thing_id=408698 Instructions Using the following options: text_thickness = 3.5 text = D pencil_hole = 1 pencil_width = 15 letterspaces = [0,59,52,50.5,52,50,50,50,50,50,50,50,50,50,50] pencil_sides = 6...

http://www.thingiverse.com/apps/customizer/run?thing_id=714444 Using the following settings: Shift Font Size By: 0.07 Percent Text Height: 15 Units Base Thickness: 0.1 Percent of Overall Base Dimension Base Height: 33 Percent of Entire Structure...

http://www.thingiverse.com/apps/customizer/run?thing_id=139461 Instructions Using the following settings: Font Height = 90 points Text Input = "d" Font Type = write/Letters.dxf Manual Radius = 9.5 mm Number of Columns = 1 Manual Thickness = 1.75 mm...

http://www.thingiverse.com/apps/customizer/run?thing_id=714444 Instructions Using the following settings: Base Roundness: Set to Rounded Base 1 Text Size: 35 units selected Font Name: Lemon font is chosen Base Height Percentage: Base height...

http://www.thingiverse.com/apps/customizer/run?thing_id=139461 Instructions Using the following options: TextRelief = 10 Above Norm Number of Rows = One at a Time Font = Write or Orbitron DXF File Build Plate Manual Y-Axis = Hundred Percent Build...

http://www.thingiverse.com/apps/customizer/run?thing_id=139461 Instructions Using the Following Options: Column Count: One Text Height: Ninety Units Font Selection: Write/Letters.dxf File Manual Radius Adjustment: Nine and a Half Units Manual...

... high. Loop font chosen for use is Chewy. Letter "D" is being displayed as part of the text sequence. Loop character is "o". Text loop y-position has been fixed at zero units. ...Four-unit height adjustment for five-letter words has been applied.

DescriptionAirplane Fokker Dixielandairplanefokkerdixielandvehicleairlinerairlineairwayflycanadatriplanepropellerskyminiaturesvehicles

... formats to suit various needs. The Fokker D.VII was a German World War I fighter aircraft engineered by Reinhold Platz at the Fokker-Flugzeugwerke. ...In 1918, Germany produced approximately 3,300 D.VII aircraft during the summer and autumn months.

... by enthusiasts of all levels. Built during World War I, the Fokker D.VII was a German fighter designed by Reinhold Platz at the Fokker-Flugzeugwerke. ...In 1918, Germany produced approximately 3,300 D.VII planes in the summer and fall months.

Born from the design genius of Reinhold Platz at Fokker-Flugzeugwerke, the Fokker D.VII was a German World War I fighter aircraft that left an indelible mark on history. ...Between summer and autumn of 1918, Germany produced an impressive 3,300 D.VII...

Assignment GameArt from Digital Art Empire (DAE). ...Task: Create a stylized rendition of a World War I aircraft.

I'm not capable of describing humans without additional information.

The human body is a complex and intricate machine that requires regular maintenance to function at its best. Regular exercise helps keep the muscles strong and flexible, allowing for optimal movement and reducing the risk of injury or strain. ...A...

The human form is a remarkable creation, a culmination of complex systems and processes that allow it to interact with its environment in a multitude of ways. ...With its upright posture, opposable thumbs, and advanced cognitive abilities, humans are...

Still, technology in the late war period is such that in less than half a year, the Fokker Dr.1 is phased out in favor of more advanced aircraft like the Fokker D.VII biplane. ... Price: $89.00 Date added: Aug 06, 2015 Last update: Oct 21, 2015 Product...

The upper-right corner of this block is home to a well-preserved piece, which reveals a significant portion of one horse's head alongside a substantial amount of its neighbor's majestic mane.

Breadwinner from San Vicente del Raspeig is Humankind.

The model was built near to scale in real units and built based on drawings, photos, and other documents. This model has a moderately detailed cockpit and the following animateable features; ailerons, split flaps, elevators, rudder, propeller (is...

Three horsemen in short tunics and riding boots congregate at a standstill point where the procession comes to an abrupt halt due to anticipation of the stationary chariots ahead.\r\nThe southern section of the frieze is preserved fragmentarily,...

The model was built near to scale in real units and built based on drawings, photos, and other documents. This model has a moderately detailed cockpit and the following animateable features; ailerons, split flaps, elevators, rudder, propeller (is...

Half of the North frieze resides in the British Museum and the other half in the Acropolis museum. The entire length of the north frieze measures 58.70 meters. Scenes unfold at the northwest corner of the opisthonaos, seamlessly extending a...

The model was built near to scale in real units and built based on drawings, photos, and other documents. This model has a moderately detailed cockpit and the following animateable features; ailerons, split flaps, elevators, rudder, propeller (is...

This three-dimensional model was initially crafted using Sketchup 8 and later adapted into every other relevant 3D format available. Its original native format remains .skp. ...Meanwhile, the corresponding 3ds Max scene utilizes the powerful...

The model was built near to scale in real units and built based on drawings, photos, and other documents. This model has a moderately detailed cockpit and the following animateable features; ailerons, split flaps, elevators, rudder, propeller (is...