chain link design 3d models
1793170 3d models found related to chain link design.
cults3d
Oblang curved chain link signet. Provided with slt,obj for 3d printing . Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelry. To be used by jewelry designers and craftsmens.
cults3d
Bent chain link motif band Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Double cuban chain link ring. Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Thin cuban chain link band Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Solid 7mm wide Cuban chain link cuff bracelet Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be scaled as you wish. To be used by jewelry designers and craftsmens. Please...
cults3d
Simple double chain link ring. Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Eternity bent chain link band. Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Elongated hexagonal chain link band Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cults3d
Hexagonal chain link band Made in solidworks 2020 with highly detailed STLs for optimum 3d printing results. Perfect for gold and silver jewelery. To be used by jewelry designers and craftsmens. Please contact us for any inquiries and...
cgtrader
ALL FILES ARE 3DM (RHINO/MATRIX) FILES IS HOLLOW READY FOR PRINT YOU CAN ALSO ADJUST SIZE ALL FILES MADE FOR GOLD also add 50 piece extra cuban link chain file as a gift for you i have uploaded 8 rar files for increase your download experience every...
cgtrader
Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiaminecklacebraceletgoldjewelryjewellerychainlinksilvergemkeychaindiamond3dprintprintablejewelnecklacesgold chaincuban chainchain necklacebracelet...
cgtrader
Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiamimonaconecklacebraceletlinkchaingoldsilverjeweljewelleryjewelry3dprintprintablediamondchockergemhiphopnecklacesgold chaincuban chainchain...
cgtrader
Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiaminecklacebraceletlinkchaingoldsilverjeweljewelleryjewelry3dprintprintablediamondchockergemnecklacesbraceletsbaguettegold chaincuban chainchain...
cgtrader
Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiamimonaconecklacebraceletlinkchaingoldsilverjeweljewelleryjewelry3dprintprintablediamondchockerhiphopbraceletsnecklacesgold chaincuban chainchain...
cgtrader
Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiamimonacogoldsilverjeweljewelleryjewelrynecklacebraceletdiamondstonegemluxuryfemalehiphopmonacochainnecklacesgold chaincuban chainchain...
thingiverse
This is a custom link from the PI camera cable chain designed specifically for 2020 extrusions in 2020 printers. Adding a snap-in connector allows for easier cable installation and reduces the risk of the cable getting caught on the printer's bed. I...
cgtrader
A diamond and gold chain with cuban links, the gold is a material and can easily be changed to silver if needed. ...Goes great with the cuban link bracelet on my profile.
cgtrader
Ready for 3d printing Miami Cuban Link Chain Ring Stackable Rings 10mm wide without any supports (because each 3d printer needs special supports for 3dmodel) Also you can find 8mm Cuban Chain Ring there :...
cgtrader
... to grow on a 3d printer. Request for custom size and custom design, we can be partner to make a great designchaincubanlinkmiamimonacogoldsilverjewelryjeweljewellery3dprintdiamondprintableluxurynecklacesgold chaincuban chainchain linkcuban link
cgtrader
#Chainring #MiamiCubanring #Linkring #Chain #Miami #Cuban #Link #jewel #jewelry #jewellery #precious #beauty #ladies #ring #mensring #womensring #luxury #rings #Doublering #Engagementring #weddingring #wedding #CoupleBands #collection #precious...
cgtrader
#Chainring #MiamiCubanring #Linkring #Chain #Miami #Cuban #Link #jewel #jewelry #jewellery #precious #beauty #ladies #ring #mensring #womensring #luxury #rings #Doublering #Engagementring #weddingring #wedding #CoupleBands #collection #precious...
cgtrader
Ready for 3d printing Miami Cuban Link Chain Ring Stackable Rings without any supports (because each 3d printer needs special supports for 3dmodel) YOU CAN FIND FULL FINGERS CHART 5-11(0.5US step) RING 7mm wide there:...
cgtrader
#Chainring #MiamiCubanring #Linkring #Chain #Miami #Cuban #Link #jewel #jewelry #jewellery #precious #beauty #ladies #ring #mensring #womensring #luxury #rings #Doublering #Engagementring #weddingring #wedding #CoupleBands #collection #precious...
cgtrader
#Chainring #MiamiCubanring #Linkring #Chain #Miami #Cuban #Link #jewel #jewelry #jewellery #precious #beauty #ladies #ring #mensring #womensring #luxury #rings #Doublering #Engagementring #weddingring #wedding #CoupleBands #collection #precious...
cgtrader
Ready for 3d printing Miami Cuban Link Chain Ring Stackable Rings 5mm wide ALL FINGER SIZES without any supports (because each 3d printer needs special supports for 3dmodel) Also you can find 7mm Cuban Chain Ring FULL US CHART there :...
thingiverse
This piece enables users to link a cable carrier directly to a 16mm tube, facilitating the exit of cables from the tube via the carrier chain, which securely holds them in place.
cgtrader
Ready for 3d printing DIAMOND Cuban Link Chain Ring Stackable Ring 5.5US and 5US sizes 3dmodel with supports and without supports two versions of STL files Also, you can find 7mm wide Cuban Chain Ring without Stones there :...
thingiverse
After printing the [Extruder Mount](https://www.thingiverse.com/thing:5230637) by [Nico8257](https://www.thingiverse.com/Nico8257) I realized that the connection point on the side that points down toward the power supply is sized for the "slim" chain...
cults3d
After printing the Extruder Mount (https://www.thingiverse.com/thing:5230637) by Nico8257 (https://www.thingiverse.com/Nico8257) I realized that the connection point on the side that points down toward the power supply is sized for the "slim" chain...
myminifactory
High Voltage BoxFence Bent 3Fence Bent 2Fence Bent 1Fence 4Fence 3Fence 2Fence 1Door 2 DoubleDoor 1Basic Post 4 WayBasic Post 3 WayBasic Post 2 Way StraightBasic Post 2 Way LBasic Post 1 Way Chain Fence A (Broken Sign)Chain Fence A (Extension A)Chain...