chain cartoon 3d models
81904 3d models found related to chain cartoon.cults3d
cartoon milkshake - cartoon milk shake
thingiverse
This creation was born from the digital womb of Tinkercad. ...Anyone can tweak and refine it live at https://www.tinkercad.com/things/5bYkzL9xjZK
cults3d
It is a KeyChain simple, quick to print and paint, based on Trevor Henderson's creatures :) Printed in black, eyes painted in white, teeth in white with blood detail in red. ... I hope you enjoy it!
3docean
Game Scene Model High-Definition Format Includes Various Models with Advanced Materials and Textures in Multiple Formats. ... Format Details: - 3D Modeling Software: Autodesk 3ds Max 2009 - Supported File Extensions: obj, 3ds, fbx
cgtrader
The model was created utilizing 3D Max 2012, which allowed for seamless export into a variety of formats including 3DS, FBX, and OBJ.
thingiverse
Here is the rewritten text: Students examine a beta-sheet from 1A0S.pdb, comprising amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, depicted as a cartoon. The visualization emphasizes stabilizing hydrogen bonds...
prusaprinters
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...
grabcad
Colorful cartoon characters leap off the page in vibrant 2D illustration style, bringing childhood magic to life through whimsical designs and dynamic poses that captivate young audiences.