chain cartoon 3d models
81731 3d models found related to chain cartoon.cults3d
cartoon milkshake - cartoon milk shake
thingiverse
This creation was born from the digital womb of Tinkercad. ...Anyone can tweak and refine it live at https://www.tinkercad.com/things/5bYkzL9xjZK
cults3d
It is a KeyChain simple, quick to print and paint, based on Trevor Henderson's creatures :) Printed in black, eyes painted in white, teeth in white with blood detail in red. ... I hope you enjoy it!
3docean
Game scene model low-modulus model, all models have materials, textures format format : 3DMax 2009 : OBJ : 3DS : FBX
cgtrader
The model was made using 3D Max 2012, Export 3DS, FBX, OBJ
thingiverse
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...
prusaprinters
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...