battlebot specifications 3d models

This is an upgrade to the h-frame y-axis carriage supplied with Anet A8 printer kits that's fastened together. Universal Prusa i3 carriage plates lack clearance for the y-axis motor and need modifications to be used. This design is a direct...

A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role....

<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...

If your print bed is small, print it diagonally, it WILL work

2" threaded pipe adapter to "Black & Decker Super Vac'n Mulch" leaf blower. ...This is meant for foundry to attach to a 2" pipe that would either have an internal combustion system with natural gas or propane.

this is a 2-round spare shell holder that I made for my precision rifle in 300 PRC, the inside of the slots are the exact dimensions of a SAAMI spec 300 PRC chamber. it might fit some other rounds like 300 win-mag or some of the RUM cartridges, I...

This is a reworked version of https://www.thingiverse.com/thing:2812350 (Mean Well LRS-350 edition) with several minor alterations: * The entire base has been shifted one millimeter in the positive X axis, according to a source comment. * The vent...

Those for rotating the filament sideways.

Dimensionally identical to the Action army rail set for the AAP-01 airsoft pistol.

The advanced Akatsuki Command Model variant is piloted by high-ranking commanders within the Black Knights organization. Exhibiting a stronger resemblance to the elite Gekka design than the standard Akatsuki configuration, it commands attention on...

<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID:...

<p>This is a remix of <a href="https://www.thingiverse.com/thing:2812350">https://www.thingiverse.com/thing:2812350</a> (Mean Well LRS-350 version) with a few small modifications:</p> <ul> <li>The entire mount is shifted one millimeter in the...

This is sort of a remix from https://www.thingiverse.com/thing:3203831 The Creality CR-6 SE has a countersunk heat sink, versus flat like on many other 3D printers. I didn't like the flat spacer used on the original so I redesigned it. I didn't...

Remix of the outstanding casefeeder created by Hari for .45 ACP. This is only the body of the feeder as it currently stands, I will upload the pusher part or simply scale his part to fit this design. It's not perfect and will require some file work...

Those individuals responsible for rotating the filament at an angle.

I'll be honest, I'd be amazed if anyone ever needs this! I have an odd use case of reusing an old mSATA SSD for my home server's boot drive and the hole spacing on it is totally wacky and doesn't fit anything. If you also bought one of those, maybe...

I learned the hard way that an ender 3 v2 tool holder won't fit the v2 neo. ...Enjoy!

Well I've tried other tensioners and all of them would bump the extruder carriage on my two-up, so I designed my own! Print at 100% infill. ...If it is too tight/loose, try scaling the model and printing again.

This remix includes changes required to use this model as part of the Magic Floating / Endless Wine Bottle Halloween decoration shown at https://youtube.com/shorts/RXX9IpVW15A. Changes to the base: - Added a "foot" to prevent the whole thing...

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made...

Remix of https://www.thingiverse.com/thing:3329838/files by Frio. Removed the power switch and modified the front panel to accommodate a fused switch socket. The PSU bottom cap has also been modified for the increased depth of the switch. I have...

This mount is designed to be both the inner Y rail corner support and the Y motor mount. it bolts onto the inside of the two rear 20mm extrusions and the Y rail extrusion. The motor mounting screw locations are designed to be recessed. M3 screws with...

This piece keeps windows at my mom's house slightly ajar, stopping them from swinging wildly with the wind. The handle of one window slides into this piece, but it's been over 10 years since the frames were installed, and age along with a few rough...

This is remix of https://www.thingiverse.com/thing:2939751 I bought the case for $10 second hand when new cases were over $120. I removed its drive bay, because it was at the bottom, where giant GPU+cooling (see my TESLA M40 92mm fan adapter)...

This mount serves as both the inner Y rail corner support and Y motor mount. It attaches to the rear of the two 20mm extrusions and the Y rail extrusion inside the frame. The recessed motor mounting screw locations use M3 screws with 8mm washers,...

I drew motivation from NickRimmer's 3-wheeled Z guide, the Re-D-Bot. Importing the model didn't work out for me, so I rebuilt it from scratch. To make it compatible with Full-Size V-Wheels instead of Mini-V wheels, modifications were made. Since I'm...

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...

A three-dimensional structure from the Protein Data Bank, designated as 1A0S, is visualized here with amino acids 334 to 387 of chain P prominently displayed. The sequence ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAIN is highlighted in balls...

<p>A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains are a...

<p>The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are...