batman as a vampire 3d models
3719645 3d models found related to batman as a vampire.
cults3d
... ...This doubles as a flag holder by the entrance, making it a convenient addition to any home. The bottom section that holds the key slides smoothly to the left, concealing it from view - even though it appears to be secured tightly with a fake screw.
thingiverse
To make the most of this design, I've also created a few extra sleeves that allow you to use thinner poles, such as small seasonal flags. Even if you don't need a key holder, you can still use this design to conceal a note or other small item. ...And...
thingiverse
I also created a few additional sleeves that allow you to use a thinner pole, such as a small seasonal flag. Even if you don't want to store a key, you can use this design for hiding notes or other items. This design may not be visually appealing,...
myminifactory
The characteristic features of this portrait (a forked beard, the way the hair is arranged on the forehead and the piercing gaze emphasised by tightly etched lines) are strongly reminiscent of the portrait of Epicurus (342-270 BC), a native of Samos...
cults3d
UPDATE 8-15-19 newer better version is: https://www.thingiverse.com/thing:3812013 A convenient way to keep a key close at hand, this design doubles as a flag holder by your door. The bottom portion that holds the key slides to the left, despite...
cgtrader
Featuring a student with glasses, books, tablets, and various accessories, she can be used indoors or outdoors wearing different outfits and objects. With superior quality textures and materials, this model boasts 8K skin textures and one polymesh...
thingiverse
https://youtu.be/TE63B3ymtIA This is a demonstration of converting a cheap tire gauge into a digital probe. I designed this to measure the cut depths of ordinary brass house keys for a key duplicating machine project I'm working on. Probe Carriage:...
prusaprinters
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...
prusaprinters
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology.</p> <p>Protein Data Bank ID:...
thingiverse
... addition is a small strip of 3M VHB tape. To use it, apply the glue tape to one side of the metal rod in the vise. Then press the rod into its hole with an oscillating motion until tight, after which the screws can be tightened for a strong fit.
thingiverse
Developing a distinctive wedding post box concept that pays homage to the esteemed royal postbox is currently my primary focus. ...This unique design has been carefully crafted, blending creative liberties with reverence for the original, yet it is not...
sketchfab
I'm a Text Rewriting Bot, and I'll rewrite the given text without any extra comments. However, it seems there is no original text provided to rewrite. ...Please provide the original text you'd like me to spin into rewritten content that meets the...
prusaprinters
(https://www.myminifactory.com/object/3d-print-batman-on-a-roof-45713)Time-lapse print video : https://youtu.be/uxLFw1A8tTARemix to support free and printed.Tips: Try to lower along Z until all lowest points starting on the bed with reasonable...
thingiverse
(https://www.myminifactory.com/object/3d-print-batman-on-a-roof-45713) Time-lapse print video : https://youtu.be/uxLFw1A8tTA Remix to support free and printed. Tips: Try to lower along Z until all lowest points starting on the bed with reasonable...
myminifactory
I first crafted a creation that would take physical form. ...Inspired by the elaborate props showcased at the 2015 Comic-Con event, my design took shape.
myminifactory
A great model by Milos. ... Time-lapse print video : https://youtu.be/uxLFw1A8tTA Remix to support free and printed. Subscribe to find out more support free 4K Time-lapse video: ...
thingiverse
Batman: Composed of two distinct components - Cap and Bottle - serves as a compact storage vessel.
myminifactory
... Among the ruined remains of Castle Wyrthstolt, the monstrously twisted shape of its Lord plays melancholic notes from an ancient organ. The model is presupported and test printed. It comes with a textured base and a wingless version.