backbone 3d models

A chair made from sheet metal forms its structure, designed solely based on images.

I am a text rewriting bot, and I will rewrite the given text exactly as it is without adding or modifying anything. ... No description provided.

3d model of a BackBone cut of meat. ...Perfect for games, scenes or renders.

Backbone bracelets, showcased in SOLIDWORKS Premium 2016, can be designed by contacting designer1986@gmail.com for an expert touch.

A simple edit of the official iPhone 13 Pro Max Backbone Adapter so that it can fit an iPhone 13 Pro Max that has an Apple brand MagSafe case on it. ...

This adapter provides a smoother experience on the Backbone One controller when used with the iPhone 13 Pro and iPhone Pro Max. The fit of this adapter will depend on the quality of printer used. Printers capable of fine-resolution prints will...

This is a mount so that you can use your cooler with your MagSafe phone in the Backbone controller. ...This also has the advantage of letting you use any MagSafe-compatible case, no matter how thick.Recommended pieces:Phone cooler:...

This is a more detailed modification of the "Backbone Adapter - iPhone 13 Pro and Pro Max", provided by BackboneOfficial, that accommodates a silicone case. It's a better fit than the other remix I've seen on here, where it appears they stretched the...

This is a simple spacer I designed for the Backbone One for Android to fit a ZFold4 with a case on. You still need to connect it via the USBC slot. It works OK with most cases, best option is a super narrow case or no case at all. V2 of this I...

https://bit.ly/3r94qFN Just a mod of the ZD Racing 9116 Pirates V3 Backbone https://www.thingiverse.com/thing:4551083 to allow it to be printed in 2 parts (which will fit on most 3d printers). Bolted together with 2x M4x20 bolts and nuts. ... I...

... As per the instructions, print both parts using 30% infill and support. Glue these parts together. The hip mounting holes measure 3mm; thus, you'll need to drill them in the hip section and use long M3 bolts for secure attachment to the backbone.

Remixed with curved edges and writings on the top.

This section of the spine was a simple task for Spider due to its geometric complexity being offset by the lack of difficult-to-scan surfaces. Scanning took 5 minutes, while processing required approximately 25 minutes. ...You can access this model at...

I tweaked the skeleton framework of the project somewhat, incorporating openings for both the audio connector and the rechargeable battery input.

The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...

Through careful analysis and design, we create a backbone for the vehicle that ensures optimal maneuverability, stability, and balance. We use state-of-the-art CAD software and simulation tools to create a chassis that can withstand the rigors of the...

The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted....

In this world, more than 70% of people get spinal problems due to bad posture. I have analyzed how this bad posture initializes Deformation ('Bone Damage' in case of med terms) due to shear & other bending stresses, neglecting the effects of...

In this world, more than 70% of people get spinal problems due to bad posture. I have analyzed how this bad posture initializes Deformation ('Bone Damage' in case of med terms) due to shear & other bending stresses, neglecting the effects of...

A molecule consisting of amino acids 1VLSPADKTNVKAAWGKVGA19, chain A, is depicted in a three-dimensional ball-and-stick format. Hydrogen bonds holding the structure together are clearly visible. This visual representation was created for...

An alpha-helix from 2HHB.pdb containing aminoacids 1VLSPADKTNVKAAWGKVGA19, chain A, visualized as balls and sticks. Stabilizing H-bonds are visible. I made this to use it for teaching Biochemistry and Structural Biology. The plan is to have a set of...

The backbone of a horse.

Ongoing project featuring a sizable backbone structure.

Goggles Fortified with a Structural Backbone

Solenoide based massage acupressure shooter for backbone

Ancient Egyptian monument, represents the backbone of divine being Osiris

Defender, stalwart protector, and rock-solid backbone of FC Barcelona.

Mess up the backbone Want me to spin more content?

Humanoid Support Droid, backbone of legendary robotic forces.

Structure Height 02 Lower Backbone Length: 600 mm Upper Backbone Type: MP-WOG / MP-WOGL Product Number: 373 Corpus Length: 405 mm