backbone case 3d models
223299 3d models found related to backbone case.
cgtrader
The transparent cross-section effectively showcases the cavity that contains the spinal cord, ensuring that medical professionals have a thorough understanding of this essential aspect of the backbone. ... 3D Model Specifications: Dimensional...
thingiverse
The Backbone Strap is the answer to loose hanging straps. Use these straps by rolling a loose strap then securing it down with an elastic band. These straps are tough as steel so they won't come undone, they leave no sticky residue like tape, and are...
thingiverse
This is a simple spacer I designed for the Backbone One for Android to fit a ZFold4 with a case on. You still need to connect it via the USBC slot. It works OK with most cases, best option is a super narrow case or no case at all. V2 of this I...
sketchfab
I am a text rewriting bot, and I will rewrite the given text exactly as it is without adding or modifying anything. ... No description provided.
grabcad
Adi PaX Pandzic, a CGPdesign team member, has embarked on an ambitious project called "paXcyborG". This involves 3D designing a humanoid robot in Solidworks, complete with all the intricate details of a human body, but in a mechanical style. The...
grabcad
A chair made from sheet metal forms its structure, designed solely based on images.
thingiverse
This also has the advantage of letting you use any MagSafe-compatible case, no matter how thick.Recommended pieces:Phone cooler: https://amazon.com/dp/B0C99GDSQLGame controller: https://amazon.com/dp/B0BYFR7GZSUSB-C extension cable:...
cgtrader
3d model of a BackBone cut of meat. ...Perfect for games, scenes or renders.
grabcad
Backbone bracelets, showcased in SOLIDWORKS Premium 2016, can be designed by contacting designer1986@gmail.com for an expert touch.
thingiverse
This adapter provides a smoother experience on the Backbone One controller when used with the iPhone 13 Pro and iPhone Pro Max. The fit of this adapter will depend on the quality of printer used. Printers capable of fine-resolution prints will...
thingiverse
https://bit.ly/3r94qFN Just a mod of the ZD Racing 9116 Pirates V3 Backbone https://www.thingiverse.com/thing:4551083 to allow it to be printed in 2 parts (which will fit on most 3d printers). Bolted together with 2x M4x20 bolts and nuts. ... I...
thingiverse
... As per the instructions, print both parts using 30% infill and support. Glue these parts together. The hip mounting holes measure 3mm; thus, you'll need to drill them in the hip section and use long M3 bolts for secure attachment to the backbone.
grabcad
I have analyzed how this bad posture initializes Deformation ('Bone Damage' in case of med terms) due to shear & other bending stresses, neglecting the effects of cartilages & other physiological elements. ...The analysis is conducted only for the...
grabcad
I have analyzed how this bad posture initializes Deformation ('Bone Damage' in case of med terms) due to shear & other bending stresses, neglecting the effects of cartilages & other physiological elements. ...The analysis is conducted only for...
thingiverse
The peptide backbone of a beta-sheet from the protein structure 1A0S, which contains amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as balls and sticks. Stabilizing hydrogen bonds between peptide...
grabcad
Through careful analysis and design, we create a backbone for the vehicle that ensures optimal maneuverability, stability, and balance. We use state-of-the-art CAD software and simulation tools to create a chassis that can withstand the rigors of the...
prusaprinters
The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted....
thingiverse
I tweaked the skeleton framework of the project somewhat, incorporating openings for both the audio connector and the rechargeable battery input.