a cartoon tree 3d models

Customized version of http://www.thingiverse.com/thing:279864 Created with Customizer! ...http://www.thingiverse.com/apps/customizer/run?thing_id=279864 Instructions Using the following options:...

Customized version of https://www.thingiverse.com/thing:279864 Created with Customizer! ...https://www.thingiverse.com/apps/customizer/run?thing_id=279864

Human: Animation 1 - Cartoon Character 1 - Tree Man Animated 3D Model Set Set 01 - Cartoon Character Model. Fully textured with large resolution (4096x4096 pixel images). Rigged and some motion capture techniques have been applied for dynamic...

A 3D cartoon dead tree character has been crafted and visualized using Blender. This versatile design comes in five different formats: Blender (default), 3DS, FBX, DAE, and OBJ. The Blender scene and node are also provided for ease of use. Each model...

A charming comedic caricature of our planet Earth

The hyper-realistic model provides a cartoonish version of yourself or lets you create a completely unique character. Improvements on this version include the addition of facial hair options, customizable hair length, and the ability to add eyebrows...

The game scene model utilizes a low-modulus approach, integrating various formats and materials across all models. ...Key specifications include: material formats in 3ds Max 2009; supported file types including OBJ, 3DS, and FBX.

The options chosen include a height of 100, long hair, mouth height of 5, nose height of 8, head tilt of 20, eye spacing of 6, mouth size of 6, top width of 4, neck of 4, nose width of 5, eye size of 6, nose size of 5, a smiling mouth type, bottom...

The options chosen include a mouth height of 5, bob hairstyle, a figure height of 100, mouth size of 5, eye spacing of 4, neck length of 4, top width of 4, head tilt of 20 degrees, nose height of 6, nose width of 5, nose size of 5, smiling mouth...

Colorful Canine Oasis A dynamic trio comes to life in the vibrant world of cartoon animals, complete with their favorite tree and a bundle of playfully animated accessories. Four diverse textures bring an added layer of depth to this charming pack.

=========== Character Cartoon Fantasy ==========

3D Cartoon Tree Model Available All necessary materials and textures come with this 3D tree model. Colors, shading details, and highlights can be achieved using the included Color Map, Normal Map, and Specular Map textures. Low-poly models are ideal...

A cute and colorful palm tree perfect for video games.

A beta-sheet from 1A0S.pdb, featuring amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387 in chain P, is visualized as a cartoon. Key H-bonds between the peptide backbone atoms are emphasized to highlight their stabilizing role....

Cartoon Tree Branch 3D Model is completely ready to be used in your games, animations, films, designs etc. All textures and materials are included and mapped in every format. The model is completely ready for use visualization in any 3d software and...

Cartoon Baobab Tree 3D Model is completely ready to be used in your games, animations, films, designs etc. All textures and materials are included and mapped in every format. The model is completely ready for use visualization in any 3d software and...

The following 3D cartoon dead tree character was created and rendered in Blender: Features include: - Five different formats are included: Blender (default), 3ds, dae, fbx, obj. - The Blender scene and node are also included. - Everything is UV...

Cartoon Tree With Hollow 3D Model is completely ready to be used in your games, animations, films, designs etc. All textures and materials are included and mapped in every format. The model is completely ready for use visualization in any 3d software...

Cartoon Tree v6 002 File Details: Polygons: 540 Vertices: 504 Textures: Yes Textures format: PNG (Diffuse, Glossiness, Reflection) Textures Size: 4096 x 4096 pixel Materials: Yes Rigged: No Animated :No UV Mapped: Yes Render Engine: Vray File formats...

Cartoon Tree v7 003 File Details: Polygons: 238 Vertices: 218 Textures: Yes, in PNG format (Diffuse, Glossiness, Reflection) Textures Size: 4096 x 4096 pixels Materials: Yes Rigged: No Animated :No UV Mapped: Yes, non-overlapping Render Engine: Vray...

Cartoon Tree v3 002 File Details: Polygons: 2980 Vertices: 2764 Textures: Yes Textures format: PNG (Diffuse, Glossiness, Reflection) Textures Size: 4096 x 4096 pixel Materials: Yes Rigged: No Animated :No UV Mapped: Yes Render Engine: Vray File...

Cartoon Tree v2 004 File Details: Polygons: 2160 Vertices: 2016 Textures: Available Textures format: PNG (Diffuse, Glossiness, Reflection) Textures Size: 4096 x 4096 pixels Materials: Yes Rigged: Not Rigged Animated: No Animation UV Mapped: Yes File...

Cartoon Christmas Tree v3 002 File Details: Polygons: 552 Vertices: 494 Textures: Yes (Diffuse, Glossiness, Reflection) Textures Format: PNG Textures Size: 4096 x 4096 pixel Materials: Yes Rigged: No Animated :No UV Mapped: Yes - File format: .ma,...

The Cartoon Tree 3D Model is now Ready for Use. All Essential Materials and Textures are Included with the Model. Color Map, Normal Map, and Specular Map Textures are Available for Your Convenience. The Low-Poly Design Makes It Ideal for Games,...

Cartoon Tree High Definition Created with Cinema 4D Pro Series Rendered with Ultimate Rendering Engine Cinema 4D Pro Series Detailed Statistics: Polypoints: 15,429 Vertices: 28,953 Compatible File Formats: 3ds Max Files Autodesk C4D Project Files...

This is a low poly 3D model of a banana tree. ...The low poly tree was modeled and prepared for low-poly style renderings, background, general CG visualization presented as 2 meshes with quads only.

This is a low poly 3D model of an almond tree. ...The low poly tree was modeled and prepared for low-poly style renderings, background, general CG visualization presented as a mesh with quads/tris.

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use it for...