3d blender models

Transformers 3 Edition Car Camaro Blender Render Cycles . with Rigging Car Includes Video Final Rendering 16 seconds ( .MP4 ) The iconic yellow Camaro transforms into Bumblebee, the beloved Autobot. ...The Chevrolet Camaro is an American automobile...

This is a scene model of a Dining Room.

This protein shaker model is designed for Ancient Nutrition. ...It comes with the original max file, an .obj file, and a render-ready KeyShot file for easy customization and visualization in your projects.

DescriptionThis is another project we made live on youtube, you can explore it and see how we approached the different problems, you can also use the assets in it to build up your own library of models to speed up your...

This is another project we made live on youtube, you can explore it and see how we approached the different problems, you can also use the assets in it to build up your own library of models to speed up your workflow

3d coins made in blender. in the file there are to variants, Silver and gold one. ... Coins are double sided.

In it, you'll witness: The 3D modeling and UV seams creation on Blender - The foundation of the model comes to life here as I demonstrate expert-level techniques to create realistic details. A deep dive into PBR materials in Substance Painter -...

This model was made in Blender v2.79 using Principed BSDF node and tested on Blender 2.8 Eevee. The body includes three 4K Handpainted difuse/albedo variations maps. (4K Normal map) Includes 6 Animations + Static pose: -Idle -Walk_001 -Walk_002 ...

I downloaded the Blender 3D model file, an impressive Athens model from Greece. The quality of this 3D model is truly exceptional. I was thrilled to discover that it's completely free to use. Every texture and decoration has been included, making it...

3d model Range Rover Land Rover Evoque 3 colors

Your visit to one of my 3D models is greatly appreciated! This is a Blender Eevee render scene file, complete with textures and materials, as well as an animated .mkv and individual .png images for each frame. If you encounter any issues with the...

This character has been modeled and packed in 3 Blender versions (2.79 and 2.8, 2.9).

This character has been modeled and packed in 3 Blender versions (2.79 and 2.8, 2.9).

DJI Phantom 4 Pro Quadcopter 3D Model with camera and remote control included.

Projector Acer with Screens high quality 3d models ready to use for your visualization or other projekts.

File Formats ==>> blend / fbx / obj. ...+ mtl Feaces ==> 1608 Verts ==> 1610Created with blender 2.83.5 and Main format is .blend , You can change setting for width ,length, curls of tennis ball hair in Particle properties of Blender.

A simple 3D model of South Korea's KF-21(KFX) Boramae Jet fighter. Modeled and rendered in Blender Cycles. ...Hope you like it!

This vehicle is designed & render in blender software#blender #3dmodeling #vehicle #tug #automotive #engineeeringdesign #Van#conceptdesign

This vehicle is designed & render in blender software#blender #3dmodeling #vehicle #tug #automotive #engineeeringdesign

BLENDER SCENE!!! ... ANIMATED EEVEE RENDER GREAT FOR WALLPAPERS

Medical jar is a 3D model with a label with separation for textures. ...A ready-made scene for Blender with materials and textures.

*BLENDER 3D FURNITURE COLLECTION: LAVABO, MIRROR AND CABINETS FOR BATHROOM.*

michelin bibendum for blender

one click fbx and obj import exporter plugin for Blender. ...adds buttons to your top menu in the Blender ui.

Office Interior design Blender Cycles 3d Scene High-quality 3D interior scene for boss office

Equipped with a fully rigged structure, this 3D model allows you to explore the intricate workings of the Porsche 911 Turbo Coupe S. From the precise movements of the suspension system to the rotating wheels, you have complete control over every...

... files, if you use another program, you can use Blender's exporter to find your desired format other than what is provided. Most shaders rely on the Principled BSDF node introduced in Blender 2.79 so you will need version 2.79 or later of Blender.

The original piece can be viewed here: https://afremov.com/city-lights-palette-knife-oil-painting-on-canvas-by-leonid-afremov-size-24x30.html All work was done in Blender, requiring no additional programs. To modify the name of the recreation,...

... With the shader you are be able to fits the colours of the cloud with your scene, So again, you have to fake it as a good 3D artist.cloudsfluffyskyhighplanesheavenshaderenvironmentcloudnaturegoldenhourblueepicoutdoorsvariousmodelsvarious models

realistic, high-quality model of rx-78 gundam with realistic decal The model is suitable for Ultra HD rendering and further use in broadcast, high-res film close-up, advertising, etc. ...The level of detail is suitable for the most extreme close-up...